ELISA Recombinant Drosophila melanogaster UPF0197 transmembrane protein CG9669(CG9669)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Drosophila melanogaster (Fruit fly) Uniprot NO.:Q9VVA8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDVMQRYVSPVNPAVFPHLATVLLVIGTFFTAWFFIFVVSRKSSKESTLIKELLISLCAS IFLGFGIVFLLLTVGIYV Protein Names:Recommended name: UPF0197 transmembrane protein CG9669 Gene Names:ORF Names:CG9669 Expression Region:1-78 Sequence Info:fµLl length protein