ELISA Recombinant Lumpy skin disease virus E3 ubiquitin-protein ligase LAP(LW010)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Lumpy skin disease virus (LSDV)
Uniprot NO.:Q91T40
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEGSDNTNTHCWICKDEYNVSTNFCNCKNEFKIVHKNCLEEWINFSHNTKCKICNGKYNIKKNKKSCLRWKCSFMYCN
Protein Names:Recommended name: E3 ubiquitin-protein ligase LAP EC= 6.3.2.-Alternative name(s): Leukemia associated protein Short name= LAP
Gene Names:Name:LW010
Expression Region:1-78
Sequence Info:fµLl length protein