ELISA Recombinant Lumpy skin disease virus E3 ubiquitin-protein ligase LAP(LW010)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Lumpy skin disease virus (LSDV) Uniprot NO.:Q91T40 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEGSDNTNTHCWICKDEYNVSTNFCNCKNEFKIVHKNCLEEWINFSHNTKCKICNGKYNIKKNKKSCLRWKCSFMYCN Protein Names:Recommended name: E3 ubiquitin-protein ligase LAP EC= 6.3.2.-Alternative name(s): Leukemia associated protein Short name= LAP Gene Names:Name:LW010 Expression Region:1-78 Sequence Info:fµLl length protein