ELISA Recombinant Kluyveromyces lactis UPF0495 protein KLLA0D04334g(KLLA0D04334g)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Uniprot NO.:Q6CS34
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MRPTQFVLNAAKKKSGFSVPVELTPLFLAMGVALASGTWFSYKKFFHDDSLRVSRKNPEQ SALDKVLNQKAE
Protein Names:Recommended name: UPF0495 protein KLLA0D04334g
Gene Names:Ordered Locus Names:KLLA0D04334g
Expression Region:1-72
Sequence Info:fµLl length protein