ELISA Recombinant Dictyostelium discoideum SURF1-like protein(surf1-1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Dictyostelium discoideum (Slime mold) Uniprot NO.:Q556J9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNKNKKGFKLFFIFPVIAFGLGTWQVYRYDWKKRLIQRAKDRMEEDPIELSNSFIKNFKG SSFGDLNKYEFRRVYLNGKVIDNQYVLLGPRSIDGTLGYYVISPLQLSDGTRILLNRGWS ASTPKSNYKIPYAIEELKLIHQKEKEQGQQQGNQESILYRYFNILGVISKTKERGSAFTP TNQPEKGQWYSLDVDAMADQLNTEPLMINTMDETEINSKPSSLPNPQFKRFDNDVESSFH NKHMSYIGTWYTLSASLFFIYFRYMRKLPK Protein Names:Recommended name: SURF1-like protein Gene Names:Name:surf1-1 ORF Names:DDB_G0272889 ANDName: surf1-2ORF Names: DDB_G0274001 Expression Region:1-270 Sequence Info:fµLl length protein