Skip to Content

ELISA Recombinant Dictyostelium discoideum UPF0197 transmembrane protein(DDB_G0288325)

https://www.americansci.com/web/image/product.template/124419/image_1920?unique=9fe42c5
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Dictyostelium discoideum (Slime mold) Uniprot NO.:Q54J38 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MALVPYTSPLDIVFYPVCAFLFCVIGFAFFATFIVSEMTTAKAQKNIFRELTLALIASMS LGLGLFFVLLAGGIYV Protein Names:Recommended name: UPF0197 transmembrane protein Gene Names:ORF Names:DDB_G0288325 Expression Region:1-76 Sequence Info:fµLl length protein

1,415.00 € 1415.0 EUR 1,415.00 €

1,415.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days