ELISA Recombinant Oedogonium cardiacum Photosystem II reaction center protein L(psbL)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Oedogonium cardiacum (Filamentous green alga) Uniprot NO.:B2X1X7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSQFDTNKLNEIDINKVSLSEVISRPNPNKQVVELNRTSLYWGLLLIFVLAVLFSSYIFN Protein Names:Recommended name: Photosystem II reaction center protein L Short name= PSII-L Alternative name(s): PSII 5 kDa protein Gene Names:Name:psbL Expression Region:1-60 Sequence Info:fµLl length protein