ELISA Recombinant Acidianus bottle-shaped virus Putative transmembrane protein ORF85 (ORF85)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Acidianus bottle-shaped virus (isolate Italy/Pozzuoli) (ABV) Uniprot NO.:A4ZUC3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVEIVGSNYFNFPPTTLIVLALGSAIAYKFLSNISTNPYVPAVLGIILVFLGHGGVISTI GAGITGLAISRAIGKDVFNFLSKVS Protein Names:Recommended name: Putative transmembrane protein ORF85 Gene Names:ORF Names:ORF85 Expression Region:1-85 Sequence Info:fµLl length protein