Skip to Content

ELISA Recombinant Lobularia maritima ATP synthase subunit c, chloroplastic(atpH)

https://www.americansci.com/web/image/product.template/142227/image_1920?unique=62ab6da
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:LobµLaria maritima (Sweet alyssum) (Alyssum maritimum) Uniprot NO.:A4QLI1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV Protein Names:Recommended name: ATP synthase subunit c, chloroplastic Alternative name(s): ATP synthase F(0) sector subunit c ATPase subunit III F-type ATPase subunit c Short name= F-ATPase subunit c Lipid-binding protein Gene Names:Name:atpH Expression Region:1-81 Sequence Info:fµLl length protein

1,420.00 € 1420.0 EUR 1,420.00 €

1,420.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days