ELISA Recombinant Prochlorococcus marinus Photosystem II reaction center protein J(psbJ)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Prochlorococcus marinus (strain MIT 9303) Uniprot NO.:A2CCQ3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSTKLKGPDGRIPDRLPDGTPAVSWERRWTEGSLPLWLVATVGGMAVLSVLGLFFFGSFT GVGSA Protein Names:Recommended name: Photosystem II reaction center protein J Short name= PSII-J Gene Names:Name:psbJ Ordered Locus Names:P9303_25321 Expression Region:1-65 Sequence Info:fµLl length protein