ELISA Recombinant Uncharacterized protein Rv0476-MT0494.1 (Rv0476, MT0494.1)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mycobacterium tubercµLosis
Uniprot NO.:P64695
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ALQRPDAYTAADKLTKPVWLVILGAAVALASILYPVLGVLGMAMSACASGVYLVDVRPKL LEIQGKSR
Protein Names:Recommended name: Uncharacterized protein Rv0476/MT0494.1
Gene Names:Ordered Locus Names:Rv0476, MT0494.1 ORF Names:MTCY20G9.02
Expression Region:20-87
Sequence Info:fµLl length protein