ELISA Recombinant UPF0057 membrane protein ZK632.10 (ZK632.10)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Caenorhabditis elegans
Uniprot NO.:P34655
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MCQILLAILAIFLPPIAVLLDVGCNCDLLINILLTCLGIIPGIIHAWYIILCKEKTVVQN IYVQTNDHGTAPPAYSPYSA
Protein Names:Recommended name: UPF0057 membrane protein ZK632.10
Gene Names:ORF Names:ZK632.10
Expression Region:1-80
Sequence Info:fµLl length protein